PDB entry 3jw9

View 3jw9 on RCSB PDB site
Description: Crystal structure of L-methionine gamma-lyase from Citrobacter freundii with S-ethyl-cysteine
Class: lyase
Keywords: pyridoxal-5'-phosphate, plp-dependent enzyme, lyase
Deposited on 2009-09-18, released 2010-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: megL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84AR1
      • see remark 999 (132)
      • see remark 999 (136)
      • see remark 999 (131)
    Domains in SCOPe 2.08: d3jw9a_
  • Heterogens: ECX, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jw9A (A:)
    msdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytr
    lgnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafl
    shsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqga
    llvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkd
    itggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqye
    lgqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvap
    eerlkagitdglirlsvgledpediindlehairkatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw9A (A:)
    sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
    gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
    hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
    lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
    tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
    gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
    erlkagitdglirlsvgledpediindlehairkat