PDB entry 3jvt

View 3jvt on RCSB PDB site
Description: Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete Light Chains
Class: contractile protein
Keywords: Regulated myosins, smooth and molluscan muscle, X-ray crystallographic structure, scallop regulatory domain/lever arm, on-state, calcium-binding protein, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament, Calcium, CONTRACTILE PROTEIN
Deposited on 2009-09-17, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain, striated adductor muscle
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain, striated adductor muscle
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jvtb_
  • Chain 'C':
    Compound: myosin essential light chain, striated adductor muscle
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jvtc_
  • Heterogens: MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jvtB (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jvtC (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk