PDB entry 3jvs

View 3jvs on RCSB PDB site
Description: Characterization of the Chk1 allosteric inhibitor binding site
Class: transferase
Keywords: Protein Kinase, ATP-binding, Cell cycle, Cytoplasm, DNA damage, DNA repair, Isopeptide bond, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Deposited on 2009-09-17, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jvsa_
  • Heterogens: AGY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jvsA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jvsA (A:)
    avpfvedwdlvqtlgeevqlavnrvteeavavkivdnikkeicinkmlnhenvvkfyghr
    reiqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenl
    llderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgi
    vltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsariti
    pdikkdrwynkplkkg