PDB entry 3jvi

View 3jvi on RCSB PDB site
Description: Product state mimic crystal structure of protein tyrosine phosphatase from Entamoeba histolytica
Class: hydrolase
Keywords: NIAID, SSGCID, Seattle Structural Genomics Center for Infectious Disease, parasitic protozoan, dysentery, liver abscess, HYDROLASE
Deposited on 2009-09-16, released 2009-09-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase
    Species: Entamoeba histolytica [TaxId:294381]
    Gene: EHI_153650
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LSE7 (4-160)
      • expression tag (3)
    Domains in SCOPe 2.05: d3jvia_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3jviA (A:)
gpgsmkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrk
vgksrgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfctti
kttevpdpyyggekgfhrvidiledacenliikleegklin

    Sequence, based on observed residues (ATOM records): (download) 
    >3jviA (A:)
smkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgk
srgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktt
evpdpygekgfhrvidiledacenliikleegklin