PDB entry 3jv0

View 3jv0 on RCSB PDB site
Description: Crystal structure of a mutant of RelB dimerization domain(M6)
Class: transcription
Keywords: NF-kB protein, intertwined homodimer, mutant, Activator, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2009-09-15, released 2010-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.221
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (0-100)
      • engineered (9)
      • engineered (36)
      • engineered (46)
      • conflict (57)
      • engineered (80)
      • conflict (88)
    Domains in SCOPe 2.08: d3jv0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv0A (A:)
    tselricridkesgpctggeelyllcdkvqkedisvrfstaswegrgdfsqadvhrqfai
    vfktppyedleisepvtvnvqlqrltdgecseplpftylpr