PDB entry 3juz

View 3juz on RCSB PDB site
Description: Crystal structure of a mutant of RelB dimerization domain(M5)
Class: transcription
Keywords: NF-kB protein, intertwined homodimer, mutant, Activator, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2009-09-15, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor relb
  Species: Mus musculus [TaxId:10090]
  Gene: Relb
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04863 (0-100)
    • engineered (9)
    • engineered (36)
    • engineered (46)
    • engineered (80)
    • conflict (88)
  Domains in SCOPe 2.07: d3juza_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3juzA (A:)
  tselricridkesgpctggeelyllcdkvqkedisvrfstaswegrgdfsqadvhrqiai
  vfktppyedleisepvtvnvqlqrltdgecseplpftylpr