PDB entry 3juy

View 3juy on RCSB PDB site
Description: Crystal Structure of a 3B3 Variant, a Broadly Neutralizing HIV-1 scFv Antibody
Class: immune system
Keywords: HIV, envelope protein gp120, broadly neutralizing antibody, 3B3 single chain variable fragment, IMMUNE SYSTEM
Deposited on 2009-09-15, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY
    Domains in SCOPe 2.07: d3juya1, d3juya2
  • Chain 'B':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY (Start-255)
    Domains in SCOPe 2.07: d3juyb1, d3juyb2
  • Chain 'C':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY (Start-255)
    Domains in SCOPe 2.07: d3juyc1, d3juyc2
  • Chain 'D':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY
    Domains in SCOPe 2.07: d3juyd1, d3juyd2
  • Chain 'E':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY
    Domains in SCOPe 2.07: d3juye1, d3juye2
  • Chain 'F':
    Compound: 3B3 single chain variant HIV-1 antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3JUY
    Domains in SCOPe 2.07: d3juyf1, d3juyf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3juyA (A:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyA (A:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsn
    rasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtkler
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3juyB (B:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyB (B:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivssggggseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlv
    ihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3juyC (C:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyC (C:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivssseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgv
    snrasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3juyD (D:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyD (D:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivsseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvs
    nrasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtkler
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3juyE (E:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyE (E:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivsseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvs
    nrasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtkler
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3juyF (F:)
    hhhhhhqvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpy
    ngnkefsakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyym
    dvwgkgttvivssggggsggggsggggseivltqapgtlslspgeratfscrsshsirsr
    rvawyqhkpgqaprlvihgvsnrasgisdrfsgsgsgtdftltitrvepedfalyycqvy
    gassytfgqgtklerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juyF (F:)
    qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
    ttvivsseivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvs
    nrasgisdrfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtkler