PDB entry 3juv

View 3juv on RCSB PDB site
Description: Crystal structure of human lanosterol 14alpha-demethylase (CYP51)
Class: Oxidoreductase
Keywords: cytochrome p450, sterol 14alpha-demethylase, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, Cholesterol biosynthesis, Endoplasmic reticulum, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Monooxygenase, NADP, Oxidoreductase, Polymorphism, Steroid biosynthesis, Sterol biosynthesis, Transmembrane
Deposited on 2009-09-15, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.199
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lanosterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP51, CYP51A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3juva_
  • Heterogens: HEM, BCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3juvA (A:)
    makktlpagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyl
    lgsdaaallfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahf
    kqhvsiieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlya
    dldggfshaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtllda
    tykdgrpltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgen
    lppltydqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvn
    qrlkdswverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlr
    lyefdlidgyfptvnyttmihtpenpvirykrrsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3juvA (A:)
    pagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaa
    allfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsi
    ieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggf
    shaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgr
    pltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlpplty
    dqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkds
    wverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdl
    idgyfptvnyttmihtpenpvirykrrs