PDB entry 3jut

View 3jut on RCSB PDB site
Description: Acidic Fibroblast Growth Factor (FGF-1) complexed with gentisic acid
Class: hormone
Keywords: GROWTH FACTOR, FGF-1 INHIBITORS, Angiogenesis, Developmental protein, Differentiation, Heparin-binding, Mitogen, HORMONE
Deposited on 2009-09-15, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3juta_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jutb_
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jutc_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jutd_
  • Chain 'E':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jute_
  • Chain 'F':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jutf_
  • Heterogens: GTQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutA (A:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutB (B:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutC (C:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutD (D:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutE (E:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jutF (F:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs