PDB entry 3jus

View 3jus on RCSB PDB site
Description: Crystal structure of human lanosterol 14alpha-demethylase (CYP51) in complex with econazole
Class: Oxidoreductase
Keywords: cytochrome P450, sterol 14alpha-demethylase, econazole, Structural Genomics, Structural Genomics Consortium, SGC, Cholesterol biosynthesis, Endoplasmic reticulum, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Monooxygenase, NADP, Oxidoreductase, Steroid biosynthesis, Sterol biosynthesis, Transmembrane
Deposited on 2009-09-15, released 2010-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lanosterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP51, CYP51A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3jusa_
  • Chain 'B':
    Compound: Lanosterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP51, CYP51A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3jusb_
  • Heterogens: HEM, ECN, ECL, BCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jusA (A:)
    makktlpagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyl
    lgsdaaallfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahf
    kqhvsiieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlya
    dldggfshaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtllda
    tykdgrpltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgen
    lppltydqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvn
    qrlkdswverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlr
    lyefdlidgyfptvnyttmihtpenpvirykrrsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jusA (A:)
    vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jusB (B:)
    makktlpagvksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyl
    lgsdaaallfnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahf
    kqhvsiieketkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlya
    dldggfshaawllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtllda
    tykdgrpltddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgen
    lppltydqlkdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvn
    qrlkdswverldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlr
    lyefdlidgyfptvnyttmihtpenpvirykrrsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jusB (B:)
    vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs