PDB entry 3jui

View 3jui on RCSB PDB site
Description: Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B epsilon Subunit
Class: translation
Keywords: HEAT repeat, guanine nucleotide exchange factor, translation initiation factor, Disease mutation, Initiation factor, Leukodystrophy, Phosphoprotein, Protein biosynthesis, TRANSLATION
Deposited on 2009-09-15, released 2009-10-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor eIF-2B subunit epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2B5, EIF2BE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13144 (8-End)
      • expression tag (0-7)
      • engineered (138)
    Domains in SCOPe 2.01: d3juia_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3juiA (A:)
ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv
vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal
gismakvlmafyqleilagetilswfsqrdttdkgqqlrknqqlqrfiqwlkeaeeesse
dd

    Sequence, based on observed residues (ATOM records): (download) 
    >3juiA (A:)
ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv
vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal
gismakvlmafyqleilagetilswfsqrddkgqqlrknqqlqrfiqwlkeaee