PDB entry 3ju9

View 3ju9 on RCSB PDB site
Description: Crystal structure of a lectin from Canavalia brasiliensis seed (ConBr) complexed with alpha-aminobutyric acid
Class: sugar binding protein
Keywords: ConBr, Lectin, Agglutinin, Canavalia Brasiliensis, Manganese, Metal-binding, SUGAR BINDING PROTEIN
Deposited on 2009-09-14, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Concanavalin-Br
  Species: Canavalia brasiliensis [TaxId:61861]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55915 (0-236)
  Domains in SCOPe 2.08: d3ju9a_
• Heterogens: DBB, GOL, CA, MN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ju9A (A:)
  adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
  lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
  hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
  iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan