PDB entry 3ju7

View 3ju7 on RCSB PDB site
Description: Crystal structure of Putative PLP-dependent aminotransferase (NP_978343.1) from Bacillus cereus ATCC 10987 at 2.19 A resolution
Class: transferase
Keywords: NP_978343.1, Putative PLP-dependent aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Pyridoxal phosphate, TRANSFERASE
Deposited on 2009-09-14, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative PLP-dependent aminotransferase
    Species: Bacillus cereus ATCC 10987 [TaxId:222523]
    Gene: BCE_2027, NP_978343.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ju7a_
  • Chain 'B':
    Compound: Putative PLP-dependent aminotransferase
    Species: Bacillus cereus ATCC 10987 [TaxId:222523]
    Gene: BCE_2027, NP_978343.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ju7b_
  • Heterogens: CA, ACT, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ju7A (A:)
    gmenipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttva
    natlglmaaiqlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlw
    dkieelkeevaivvpyatfgswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfs
    gmiiysfhatkpfgigeggliyskneediqrikrmgnfgfdtnrectmmgfnckmseyaa
    aigiatmkkwddklkertrisewykqllqsnglmkkgwqlqkteaviqqfmpilcpeevr
    nkqviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegmtkei
    veqiviclgqkvvsade
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ju7A (A:)
    enipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttvana
    tlglmaaiqlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlwdk
    ieelkeevaivvpyatfgswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfsgm
    iiysfhatkpfgigeggliyskneediqrikrmgnfgfdtnrectmmgfnckmseyaaai
    giatmkkwddklkertrisewykqllqsnglmkkgwqlqkteaviqqfmpilcpeevrnk
    qviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegmtkeive
    qiviclgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ju7B (B:)
    gmenipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttva
    natlglmaaiqlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlw
    dkieelkeevaivvpyatfgswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfs
    gmiiysfhatkpfgigeggliyskneediqrikrmgnfgfdtnrectmmgfnckmseyaa
    aigiatmkkwddklkertrisewykqllqsnglmkkgwqlqkteaviqqfmpilcpeevr
    nkqviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegmtkei
    veqiviclgqkvvsade
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ju7B (B:)
    enipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttvana
    tlglmaaiqlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlwdk
    ieelkeevaivvpyatfgswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfsgm
    iiysfhatkpfgigeggliyskneediqrikrmgnfgfdtnrectmmgfnckmseyaaai
    giatmkkwddklkertrisewykqllqsnglmkkgwqlqkteaviqqfmpilcpeevrnk
    qviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegmtkeive
    qiviclgq