PDB entry 3jtx

View 3jtx on RCSB PDB site
Description: Crystal structure of Aminotransferase (NP_283882.1) from NEISSERIA MENINGITIDIS Z2491 at 1.91 A resolution
Class: transferase
Keywords: NP_283882.1, Aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Transferase
Deposited on 2009-09-14, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Neisseria meningitidis Z2491 [TaxId:122587]
    Gene: NMA1113, NP_283882.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1IRD6 (1-395)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3jtxa1, d3jtxa2
  • Chain 'B':
    Compound: aminotransferase
    Species: Neisseria meningitidis Z2491 [TaxId:122587]
    Gene: NMA1113, NP_283882.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jtxb_
  • Heterogens: MES, GOL, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jtxA (A:)
    gmntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhele
    kypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvsdgik
    paivspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnp
    sgsvldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmf
    tslskrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnr
    rlyqekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrfla
    rdteqgnpgegyvrialvadvatcvkaaedivslyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jtxA (A:)
    gmntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhele
    kypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpgikpai
    vspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnpsgs
    vldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmftsl
    skrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrrly
    qekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflardt
    eqgnpgegyvrialvadvatcvkaaedivslyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jtxB (B:)
    gmntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhele
    kypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvsdgik
    paivspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnp
    sgsvldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmf
    tslskrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnr
    rlyqekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrfla
    rdteqgnpgegyvrialvadvatcvkaaedivslyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jtxB (B:)
    mntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhelek
    ypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvgikpai
    vspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnpsgs
    vldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmftsl
    skrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrrly
    qekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflardt
    eqgnpgegyvrialvadvatcvkaaedivslyr