PDB entry 3jtt

View 3jtt on RCSB PDB site
Description: Cystal structure of Rhesus macaque MHC class I:Mamu-A*02
Class: immune system
Keywords: ALPHA HELIX, BETA SHEET, BETA BARREL, Immune response, MHC I, Membrane, Transmembrane, Disease mutation, Disulfide bond, Glycation, Glycoprotein, Immunoglobulin domain, Pyrrolidone carboxylic acid, Secreted, IMMUNE SYSTEM
Deposited on 2009-09-14, released 2010-09-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I Mamu-A*02
    Species: Macaca mulatta [TaxId:9544]
    Gene: Mamu
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Macaca mulatta [TaxId:9544]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6V7J5 (1-99)
      • expression tag (0)
  • Chain 'C':
    Compound: peptide of Protein Nef
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MHC class I Mamu-A*02
    Species: Macaca mulatta [TaxId:9544]
    Gene: Mamu
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Macaca mulatta [TaxId:9544]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6V7J5 (1-99)
      • expression tag (0)
  • Chain 'F':
    Compound: peptide of Protein Nef
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: MHC class I Mamu-A*02
    Species: Macaca mulatta [TaxId:9544]
    Gene: Mamu
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Macaca mulatta [TaxId:9544]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6V7J5 (1-99)
      • expression tag (0)
    Domains in SCOPe 2.03: d3jtth_
  • Chain 'I':
    Compound: peptide of Protein Nef
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jttH (H:)
    miqrtpkiqvysrhppengkpnflncyvsgfhpsdievdllkngekmgkvehsdlsfskd
    wsfyllyyteftpnekdeyacrvnhvtlsgprtvkwdrdm
    

  • Chain 'I':
    No sequence available.