PDB entry 3jtb

View 3jtb on RCSB PDB site
Description: Cu(II) N47S/F114N variant of Pseudomonas Aeruginosa Azurin
Class: transport protein
Keywords: CUPREDOXIN, AZURIN, GREEK KEY, BETA BARREL, ELECTRON TRANSFER, Copper, Disulfide bond, Electron transport, Metal-binding, Periplasm, Transport, TRANSPORT PROTEIN
Deposited on 2009-09-11, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: azu, Azurin, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (46)
      • engineered (113)
    Domains in SCOPe 2.07: d3jtba_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: azu, Azurin, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (46)
      • engineered (113)
    Domains in SCOPe 2.07: d3jtbb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: azu, Azurin, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (46)
      • engineered (113)
    Domains in SCOPe 2.07: d3jtbc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: azu, Azurin, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (46)
      • engineered (113)
    Domains in SCOPe 2.07: d3jtbd_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtbA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtbB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtbC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtbD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal
    mkgtltlk