PDB entry 3jss

View 3jss on RCSB PDB site
Description: Crystal structure of a mutant RelB dimerization domain
Class: transcription
Keywords: NF-kB, intertwined dimer, Activator, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2009-09-10, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (0-100)
      • engineered (36)
      • engineered (46)
      • engineered (80)
      • conflict (88)
    Domains in SCOPe 2.07: d3jssa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jssA (A:)
tselricrinkesgpctggeelyllcdkvqkedisvrfstaswegrgdfsqadvhrqiai
vfktppyedleisepvtvnvqlqrltdgecseplpftylpr