PDB entry 3jsc

View 3jsc on RCSB PDB site
Description: CcdBVfi-FormI-pH7.0
Class: Toxin
Keywords: ALPHA+BETA, SH3 domain, Toxin
Deposited on 2009-09-10, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ccdb
    Species: Vibrio fischeri [TaxId:668]
    Gene: CCDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jsca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jscA (A:)
    msqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihi
    degdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jscA (A:)
    sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellcptihidegdfimlt
    qqmtsvpvkilsepvnelstfrneiiaaidflitgi