PDB entry 3jr5

View 3jr5 on RCSB PDB site
Description: MutM lesion recognition control complex with N174C crosslinking site
Class: Lyase/DNA
Keywords: DNA glycosylase, DNA repair, damage search, base extrusion, disulfide crosslinking, DNA damage, DNA-binding, Glycosidase, Hydrolase, Lyase, Metal-binding, Multifunctional enzyme, Zinc-finger, Lyase-DNA COMPLEX
Deposited on 2009-09-08, released 2009-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA glycosylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84131 (0-272)
      • engineered (172)
    Domains in SCOPe 2.04: d3jr5a1, d3jr5a2, d3jr5a3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*gp*tp*ap*gp*ap*cp*tp*cp*gp*gp*ap*cp*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*cp*gp*tp*cp*cp*(ogx)p*ap*gp*tp*cp*tp*ap*cp*c)-3')
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jr5A (A:)
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgciyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
ygrqgnpckrcgtpiektvvagrgthycprcqr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.