PDB entry 3jql

View 3jql on RCSB PDB site
Description: Crystal Structure of the Complex Formed Between Phospholipase A2 and a Hexapeptide Fragment of Amyloid Beta Peptide, Lys-Leu-Val-Phe-Phe-Ala at 1.2 A Resolution
Class: hydrolase
Keywords: PHOSPHOLIPASE A2, CRYSTAL STRUCTURE, HEXAPEPTIDE, AMYLOID BETA, HYDROLASE, Calcium, Disulfide bond, Lipid degradation, Metal-binding, Secreted
Deposited on 2009-09-07, released 2009-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.187
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-118)
      • see remark 999 (18)
      • see remark 999 (45)
    Domains in SCOPe 2.08: d3jqla_
  • Chain 'B':
    Compound: Amyloid Beta Peptide
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jqlA (A:)
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

  • Chain 'B':
    No sequence available.