PDB entry 3jq7

View 3jq7 on RCSB PDB site
Description: Crystal structure of pteridine reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6-phenylpteridine-2,4,7-triamine (DX2)
Class: oxidoreductase
Keywords: pteridine reductase, ptr1, trypanosoma brucei, short chain dehydrogenase, inhibitor, oxidoreductase
Deposited on 2009-09-06, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PTR1, Tb927.8.2210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jq7a_
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PTR1, Tb927.8.2210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jq7b_
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PTR1, Tb927.8.2210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jq7c_
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PTR1, Tb927.8.2210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jq7d_
  • Heterogens: NAP, DX2, ACT, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jq7A (A:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jq7A (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jq7B (B:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jq7B (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiap
    flltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvng
    vapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdg
    glslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3jq7C (C:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jq7C (C:)
    apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
    ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaiap
    flltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvng
    vapgvsllpdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3jq7D (D:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jq7D (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha