PDB entry 3jpz

View 3jpz on RCSB PDB site
Description: Crystal Structure of Lombricine Kinase
Class: transferase
Keywords: Mixed alpha / beta, Kinase, Transferase
Deposited on 2009-09-04, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lombricine kinase
    Species: Urechis caupo [TaxId:6431]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jpza1, d3jpza2
  • Chain 'B':
    Compound: Lombricine kinase
    Species: Urechis caupo [TaxId:6431]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jpzb1, d3jpzb2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jpzA (A:)
    mafqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncig
    liagdeesyevfkelfdavinekhkgfgpndsqpapdldasklvggqfdekyvkscrirt
    grgirglcyppsctrgerrevervittalaglsgdlsgtyyplskmtpeqenqliadhfl
    fqkptghlmvnsasvrdwpdargiwhnnektfliwineedhmrvismqkggnvkavferf
    grglnaiaeqmkkngreymwnqrlgylcacpsnlgtglrasvhvqlhqlskhpkfedivv
    alqlqkrgtggehtaavddvydisnaarlkkserefvqllidgvkklidmeqaleagksi
    ddlipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jpzA (A:)
    fqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncigli
    agdeesyevfkelfdavinekhkgfgpndsqpapdldasklvggqfdekyvkscrirtgr
    girglcyppsctrgerrevervittalaglsgdlsgtyyplskmtpeqenqliadhflfq
    kptghlmvnsasvrdwpdargiwhnnektfliwineedhmrvismqkggnvkavferfgr
    glnaiaeqmkkngreymwnqrlgylcacpsnlgtglrasvhvqlhqlskhpkfedivval
    qlqkrgtggehtaavddvydisnaarlkkserefvqllidgvkklidmeqaleagksidd
    lipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jpzB (B:)
    mafqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncig
    liagdeesyevfkelfdavinekhkgfgpndsqpapdldasklvggqfdekyvkscrirt
    grgirglcyppsctrgerrevervittalaglsgdlsgtyyplskmtpeqenqliadhfl
    fqkptghlmvnsasvrdwpdargiwhnnektfliwineedhmrvismqkggnvkavferf
    grglnaiaeqmkkngreymwnqrlgylcacpsnlgtglrasvhvqlhqlskhpkfedivv
    alqlqkrgtggehtaavddvydisnaarlkkserefvqllidgvkklidmeqaleagksi
    ddlipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jpzB (B:)
    fqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncigli
    agdeesyevfkelfdavinekhkgfgpndsqpapdldasklvggqfdekyvkscrirtgr
    girglcyppsctrgerrevervittalaglsgdlsgtyyplskmtpeqenqliadhflfq
    kptghlmvnsasvrdwpdargiwhnnektfliwineedhmrvismqkggnvkavferfgr
    glnaiaeqmkkngreymwnqrlgylcacpsnlgtglrasvhvqlhqlskhpkfedivval
    qlqkrgtggehtaavddvydisnaarlkkserefvqllidgvkklidmeqaleagksidd
    li