PDB entry 3jdw

View 3jdw on RCSB PDB site
Description: crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis
Class: transferase
Keywords: transferase, creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry
Deposited on 1997-01-24, released 1998-01-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arginine:glycine amidinotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: AT38H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3jdwa_
  • Heterogens: ORN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jdwA (A:)
    mlrvrclrggsrgaeavhyigsrlgrtltgwvqrtfqstqaatassrnscaaddkatepl
    pkdcpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhl
    kkavaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneii
    eapmawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaa
    qgkfvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpn
    pmhidatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsm
    nvlmldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqs
    yld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jdwA (A:)
    cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
    vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
    mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
    fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
    idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
    mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld