PDB entry 3ixo

View 3ixo on RCSB PDB site
Description: Crystal Structure of uncomplexed HIV_1 Protease Subtype A
Class: hydrolase
Keywords: HIV-1 Protease, Subtype A, Uncomplexed, Aspartyl protease, Hydrolase, Multifunctional enzyme, Nucleotidyltransferase, Protease, RNA-directed DNA polymerase, Transferase
Deposited on 2009-09-04, released 2010-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:505184]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WEZ1 (0-98)
    • variant (34)
    • variant (80)
  Domains in SCOPe 2.08: d3ixoa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:505184]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WEZ1 (0-98)
    • variant (34)
    • variant (80)
  Domains in SCOPe 2.08: d3ixob_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ixoA (A:)
  pqitlwqrplvtvkiggqlrealldtgaddtvleeinlpgkwkpkmiggiggfikvkqyd
  qilieicgkkaigtvlvgptsvniigrnmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ixoB (B:)
  pqitlwqrplvtvkiggqlrealldtgaddtvleeinlpgkwkpkmiggiggfikvkqyd
  qilieicgkkaigtvlvgptsvniigrnmltqigctlnf