PDB entry 3ixc

View 3ixc on RCSB PDB site
Description: Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum
Class: transferase
Keywords: NIAID, SSGCID, Seattle Structural Genomics Center for Infectious Disease, gram-negative bacteria, human granulocytic anaplasmosis, beta helix, Transferase
Deposited on 2009-09-03, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hexapeptide transferase family protein
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: APH_1197
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ixca_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ixcA (A:)
    mahhhhhhmgtleaqtqgpgsmrevlvpyagvspsvdstafiagnariigdvcigknasi
    wygtvlrgdvdkievgegtniqdntvvhtdsmhgdtvigkfvtighscilhactlgnnaf
    vgmgsivmdravmeegsmlaagslltrgkivksgelwagrpakflrmmteeeilylqksa
    enyialsrgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixcA (A:)
    mrevlvpyagvspsvdstafiagnariigdvcigknasiwygtvlrgdvdkievgegtni
    qdntvvhtgdtvigkfvtighscilhactlgnnafvgmgsivmdravmeegsmlaagsll
    trgkivksgelwagrpakflrmmteeeilylqksaenyialsrgyl