PDB entry 3iwl

View 3iwl on RCSB PDB site
Description: Crystal structure of cisplatin bound to a human copper chaperone (monomer)
Class: metal transport
Keywords: beta-alpha-beta-beta-alpha-beta, transport protein, cisplatin, platinum, Chaperone, Copper, Copper transport, Ion transport, Metal-binding, Transport, METAL TRANSPORT
Deposited on 2009-09-02, released 2009-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3iwla_
  • Heterogens: PT, SO4, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iwlA (A:)
    mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
    tvsylgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwlA (A:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylgl