PDB entry 3iw5

View 3iw5 on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with an Indole Derivative
Class: transferase
Keywords: DFG-out, Type-I, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-09-02, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered (118)
      • engineered (161)
      • engineered (326)
    Domains in SCOPe 2.06: d3iw5a_
  • Heterogens: BOG, DF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iw5A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglcrhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqslesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iw5A (A:)
    erptfyrqelnktiwevperyqnlspvgsygsvcaafdtktglrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglatrwyrapeimlnw
    mhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarn
    yiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdde
    pvadpydqslesrdllidewksltydevisfvpppl