PDB entry 3iw4

View 3iw4 on RCSB PDB site
Description: Crystal structure of PKC alpha in complex with NVP-AEB071
Class: transferase
Keywords: kinase, ATP-binding, Cell membrane, Membrane, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Zinc-finger
Deposited on 2009-09-02, released 2009-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C alpha type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCA, PKCA, PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17252
      • engineered (178)
    Domains in SCOPe 2.06: d3iw4a_
  • Chain 'B':
    Compound: Protein kinase C alpha type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCA, PKCA, PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17252
      • engineered (178)
    Domains in SCOPe 2.06: d3iw4b_
  • Chain 'C':
    Compound: Protein kinase C alpha type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCA, PKCA, PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17252
      • engineered (178)
    Domains in SCOPe 2.06: d3iw4c_
  • Heterogens: LW4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iw4A (A:)
    mpsedrkqpsnnldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqd
    ddvectmvekrvlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkep
    qavfyaaeisiglfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttref
    cgtpdyiapeiiayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsyp
    kslskeavsickglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkv
    cgkgaenfdkfftrgqpvltppdqlvianidqsdfegfsyvnpqfvhpilqsavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iw4A (A:)
    ldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekrv
    lalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisig
    lfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrefcgtpdyiapeii
    ayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsick
    glmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkvfdkfftrgqpvl
    tppdqlvianidqsdfegfsyvnpqfvhpilq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iw4B (B:)
    mpsedrkqpsnnldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqd
    ddvectmvekrvlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkep
    qavfyaaeisiglfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttref
    cgtpdyiapeiiayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsyp
    kslskeavsickglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkv
    cgkgaenfdkfftrgqpvltppdqlvianidqsdfegfsyvnpqfvhpilqsavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iw4B (B:)
    drvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekrvl
    alldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisigl
    fflhkrgiiyrdlkldnvmldseghikiadfgmckehmmgvttrefcgtpdyiapeiiay
    qpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsickgl
    mtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkvfdkfftrgqpvltp
    pdqlvianidqsdfegfsyvnpqfvhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iw4C (C:)
    mpsedrkqpsnnldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqd
    ddvectmvekrvlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkep
    qavfyaaeisiglfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttref
    cgtpdyiapeiiayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsyp
    kslskeavsickglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkv
    cgkgaenfdkfftrgqpvltppdqlvianidqsdfegfsyvnpqfvhpilqsavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iw4C (C:)
    nldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekr
    vlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisi
    glfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrefcgtpdyiapei
    iayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsic
    kglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkvfdkfftrgqpv
    ltppdqlvianidqsdfegfsyvnpqfvhpilqs