PDB entry 3ivv

View 3ivv on RCSB PDB site
Description: Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATH-PucSBC1_pep1
Class: ligase
Keywords: Protein Binding, Nucleus, Ubl conjugation pathway, LIGASE
Deposited on 2009-09-01, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.18
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43791 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3ivva1, d3ivva2
  • Chain 'D':
    Compound: PucSBC1
    Database cross-references and differences (RAF-indexed):
    • PDB 3IVV (0-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ivvA (A:)
    gsggsgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeesk
    dylslylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdf
    lldeangllpddkltlfcevsvvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ivvA (A:)
    sgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdyls
    lylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdfllde
    angllpddkltlfcevsvvq
    

  • Chain 'D':
    No sequence available.