PDB entry 3iuy

View 3iuy on RCSB PDB site
Description: Crystal structure of DDX53 DEAD-box domain
Class: hydrolase
Keywords: REC-A-like, DEAD-box, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Helicase, Hydrolase, Nucleotide-binding, Nucleus, RNA-binding
Deposited on 2009-08-31, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX53
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX53, CAGE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86TM3 (1-227)
      • expression tag (0)
      • variant (40)
    Domains in SCOPe 2.06: d3iuya1, d3iuya2
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX53
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX53, CAGE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86TM3 (1-227)
      • expression tag (0)
      • variant (40)
    Domains in SCOPe 2.06: d3iuyb1, d3iuyb2
  • Heterogens: AMP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iuyA (A:)
    mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
    ivvaqtgtgktlsylmpgfihldsqpisreqrngpgmlvltptrelalhveaecskysyk
    glksiciyggrnrngqiediskgvdiiiatpgrlndlqmnnsvnlrsitylvideadkml
    dmefepqirkilldvrpdrqtvmtsatwpdtvrqlalsylkdpmivyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iuyA (A:)
    mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
    ivvaqtgtgktlsylmpgfihldngpgmlvltptrelalhveaecskysykglksiciyg
    qiediskgvdiiiatpgrlndlqmnnsvnlrsitylvideadkmldmefepqirkilldv
    rpdrqtvmtsatwpdtvrqlalsylkdpmivyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iuyB (B:)
    mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
    ivvaqtgtgktlsylmpgfihldsqpisreqrngpgmlvltptrelalhveaecskysyk
    glksiciyggrnrngqiediskgvdiiiatpgrlndlqmnnsvnlrsitylvideadkml
    dmefepqirkilldvrpdrqtvmtsatwpdtvrqlalsylkdpmivyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iuyB (B:)
    mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
    ivvaqtgtgktlsylmpgfihldsngpgmlvltptrelalhveaecskysykglksiciy
    gvdiiiatpgrlndlqmnnsvnlrsitylvideadkmldmefepqirkilldvrpdrqtv
    mtsatwpdtvrqlalsylkdpmivyv