PDB entry 3iug

View 3iug on RCSB PDB site
Description: Crystal structure of the RhoGAP domain of RICS
Class: splicing
Keywords: Structural Genomics Consortium (SGC), GAP, Alternative splicing, Cell junction, Cell membrane, Cell projection, Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, GTPase activation, Membrane, Phosphoprotein, Postsynaptic cell membrane, SH3 domain, Synapse, SPLICING
Deposited on 2009-08-31, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho/Cdc42/Rac GTPase-activating protein RICS
    Species: Homo sapiens [TaxId:9606]
    Gene: GI:134105571, GRIT, KIAA0712, RICS
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7KAX9 (18-End)
      • expression tag (17)
    Domains in SCOPe 2.07: d3iuga1, d3iuga2
  • Chain 'B':
    Compound: Rho/Cdc42/Rac GTPase-activating protein RICS
    Species: Homo sapiens [TaxId:9606]
    Gene: GI:134105571, GRIT, KIAA0712, RICS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iugb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iugA (A:)
    mhhhhhhssgrenlyfqgervfgcdlgehllnsgfevpqvlqsctafierygivdgiyrl
    sgvasniqrlrhefdsehvpdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsd
    avsaatdeerlikihdviqqlppphyrtleflmrhlslladycsitnmhaknlaivwapn
    llrskqiesacfsgtaafmevriqsvvvefilnhvdvlfsgrismamqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iugA (A:)
    gervfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdse
    hvpdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdv
    iqqlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrsqsvvvefilnhvd
    vlfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iugB (B:)
    mhhhhhhssgrenlyfqgervfgcdlgehllnsgfevpqvlqsctafierygivdgiyrl
    sgvasniqrlrhefdsehvpdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsd
    avsaatdeerlikihdviqqlppphyrtleflmrhlslladycsitnmhaknlaivwapn
    llrskqiesacfsgtaafmevriqsvvvefilnhvdvlfsgrismamqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iugB (B:)
    rvfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdsehv
    pdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdviq
    qlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrsvriqsvvvefilnhv
    dvlfsg