PDB entry 3iu5

View 3iu5 on RCSB PDB site
Description: Crystal structure of the first bromodomain of human poly-bromodomain containing protein 1 (PB1)
Class: transcription
Keywords: PB1, polybromo 1 isoform 1, BAF180, Polybromo0ID, PBRM1, BRG1-associated factor 180, Structural Genomics, SGC, Structural Genomics Consortium, Bromodomain, Chromatin regulator, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2009-08-30, released 2009-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.17
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein polybromo-1
  Species: Homo sapiens [TaxId:9606]
  Gene: PB1, PBRM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86U86 (2-113)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d3iu5a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3iu5A (A:)
  smtvdpiavchelyntirdykdeqgrllcelfirapkrrnqpdyyevvsqpidlmkiqqk
  lkmeeyddvnlltadfqllfnnaksyykpdspeykaacklwdlylrtrnefvqkge
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3iu5A (A:)
  smtvdpiavchelyntirdykdeqgrllcelfirapkrrnqpdyyevvsqpidlmkiqqk
  lkmeeyddvnlltadfqllfnnaksyykpdspeykaacklwdlylrtrnefvqk