PDB entry 3iu4

View 3iu4 on RCSB PDB site
Description: anti NeuGcGM3 ganglioside chimeric antibody chP3
Class: immune system
Keywords: antibody, ganglioside, idiotype, IMMUNE SYSTEM
Deposited on 2009-08-29, released 2009-12-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.196
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chP3 Fab heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IU4 (0-End)
  • Chain 'L':
    Compound: chP3 Fab light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IU4 (0-212)
    Domains in SCOPe 2.05: d3iu4l1, d3iu4l2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iu4L (L:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhystpwtfgggtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge