PDB entry 3itz

View 3itz on RCSB PDB site
Description: Crystal Structure of p38a Mitogen-Activated Protein Kinase in Complex with a Pyrazolopyridazine Inhibitor
Class: Transferase
Keywords: Serine/Threonine-Protein Kinase, Transferase, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism
Deposited on 2009-08-28, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (6-End)
      • expression tag (2-5)
    Domains in SCOPe 2.06: d3itza1, d3itza2
  • Heterogens: P66, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3itzA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itzA (A:)
    hmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkls
    rpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnni
    vkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtd
    demtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklil
    rlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkr
    itaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl