PDB entry 3itp

View 3itp on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS F34K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Endonuclease, Membrane, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2009-08-28, released 2010-07-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.204
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (33)
      • engineered (43-44)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.05: d3itpa_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3itpA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtkrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itpA (A:)
    lhkepatlikaidgdtvklmykgqpmtkrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws