PDB entry 3itm

View 3itm on RCSB PDB site
Description: Catalytic domain of hPDE2A
Class: hydrolase
Keywords: ZN-binding, All-ALPHA HELICAL, cGMP, Hydrolase, Membrane
Deposited on 2009-08-28, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A, PDE2A 579-919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3itma_
  • Chain 'B':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A, PDE2A 579-919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3itmb_
  • Chain 'C':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A, PDE2A 579-919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3itmc_
  • Chain 'D':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A, PDE2A 579-919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3itmd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3itmA (A:)
    gsamddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnyki
    dcptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscm
    chdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdy
    qrmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtk
    gwkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykll
    qdlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itmA (A:)
    dgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvk
    kgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsf
    qvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiila
    tdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliy
    keffslekammemmdrekayipelqisfmehiampiykllqdlfpkaaelyervasnreh
    wtkvshk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3itmB (B:)
    gsamddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnyki
    dcptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscm
    chdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdy
    qrmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtk
    gwkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykll
    qdlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itmB (B:)
    ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
    larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
    dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
    dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
    trkiaeliykeffsqekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka
    aelyervasnrehwtkvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3itmC (C:)
    gsamddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnyki
    dcptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscm
    chdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdy
    qrmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtk
    gwkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykll
    qdlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itmC (C:)
    ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
    larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
    dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
    dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
    trkiaeliykeffsekammemmdrekayipelqisfmehiampiykllqdlfpkaaelye
    rvasnrehwt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3itmD (D:)
    gsamddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnyki
    dcptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscm
    chdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdy
    qrmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtk
    gwkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykll
    qdlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3itmD (D:)
    ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
    larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
    dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
    dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
    trkiaeliykeffsqekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka
    aelyervasnrehwtkvs