PDB entry 3it9

View 3it9 on RCSB PDB site
Description: Crystal structure of Penicillin-Binding Protein 6 (PBP6) from E. coli in apo state
Class: hydrolase
Keywords: Penicillin-Binding Protein, PBP6, DD-carboxypeptidase, peptidoglycan, Carboxypeptidase, Cell inner membrane, Cell membrane, Cell shape, Cell wall biogenesis/degradation, Hydrolase, Membrane, Peptidoglycan synthesis, Protease
Deposited on 2009-08-27, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanyl-D-alanine carboxypeptidase dacC
    Species: Escherichia coli [TaxId:562]
    Gene: DACC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3it9a1, d3it9a2
  • Chain 'B':
    Compound: D-alanyl-D-alanine carboxypeptidase dacC
    Species: Escherichia coli [TaxId:562]
    Gene: DACC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3it9b1, d3it9b2
  • Chain 'C':
    Compound: D-alanyl-D-alanine carboxypeptidase dacC
    Species: Escherichia coli [TaxId:562]
    Gene: DACC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3it9c1, d3it9c2
  • Chain 'D':
    Compound: D-alanyl-D-alanine carboxypeptidase dacC
    Species: Escherichia coli [TaxId:562]
    Gene: DACC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3it9d1, d3it9d2
  • Heterogens: SO4, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3it9A (A:)
    maeqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkik
    ltdmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvag
    sqesfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihk
    ekeftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgakt
    drirfneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgq
    lknlkasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it9A (A:)
    tveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdm
    vtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqes
    figlmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekef
    tfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrir
    fneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknl
    kasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3it9B (B:)
    maeqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkik
    ltdmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvag
    sqesfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihk
    ekeftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgakt
    drirfneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgq
    lknlkasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it9B (B:)
    apsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdmvtv
    gkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqesfig
    lmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekeftfn
    kirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrirfne
    seklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkas
    ytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3it9C (C:)
    maeqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkik
    ltdmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvag
    sqesfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihk
    ekeftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgakt
    drirfneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgq
    lknlkasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it9C (C:)
    eapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdmvt
    vgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqesfi
    glmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekeftf
    nkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrirfn
    eseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlka
    sytltepqltaplkkgqvvgtidfqlgksieqrplivmenveegg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3it9D (D:)
    maeqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkik
    ltdmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvag
    sqesfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihk
    ekeftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgakt
    drirfneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgq
    lknlkasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it9D (D:)
    eqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkiklt
    dmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsq
    esfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkek
    eftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdr
    irfneseklltwgfrffetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlk
    nlkasytltepqltaplkkgqvvgtidfqlngksieqrplivmenveegg