PDB entry 3it8

View 3it8 on RCSB PDB site
Description: Crystal structure of TNF alpha complexed with a poxvirus MHC-related TNF binding protein
Class: immune system
Keywords: MHC CLASS I HOMOLOG, Cell membrane, Cytokine, Disulfide bond, Glycoprotein, Lipoprotein, Membrane, Myristate, Phosphoprotein, Secreted, Signal-anchor, Transmembrane, IMMUNE SYSTEM
Deposited on 2009-08-27, released 2009-10-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8a_
  • Chain 'B':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8b_
  • Chain 'C':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8c_
  • Chain 'D':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8g_
  • Chain 'H':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8h_
  • Chain 'I':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (9-160)
      • conflict (146)
    Domains in SCOPe 2.01: d3it8i_
  • Chain 'J':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 2L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Gene: 2L
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3it8A (A:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8A (A:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3it8B (B:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8B (B:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3it8C (C:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8C (C:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3it8G (G:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8G (G:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3it8H (H:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8H (H:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3it8I (I:)
    mgshhhhhhrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpsegly
    liysqvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwye
    piylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3it8I (I:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.