PDB entry 3isw

View 3isw on RCSB PDB site
Description: Crystal structure of filamin-A immunoglobulin-like repeat 21 bound to an N-terminal peptide of CFTR
Class: structural protein
Keywords: protein-peptide complex, Acetylation, Actin-binding, Alternative splicing, Cytoplasm, Cytoskeleton, Disease mutation, Phosphoprotein, Polymorphism, ATP-binding, Chloride, Chloride channel, Glycoprotein, Hydrolase, Ion transport, Ionic channel, Membrane, Nucleotide-binding, Transmembrane, Transport, STRUCTURAL PROTEIN
Deposited on 2009-08-27, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.264
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLN, FLN-21, FLN1, FLNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iswa_
  • Chain 'B':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLN, FLN-21, FLN1, FLNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iswb_
  • Chain 'C':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569 (0-17)
      • engineered (16)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3iswA (A:)
gampdggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkd
gscgvayvvqepgdyevsvkfneehipdspfvvpvasps

    Sequence, based on observed residues (ATOM records): (download) 
    >3iswA (A:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3iswB (B:)
gampdggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkd
gscgvayvvqepgdyevsvkfneehipdspfvvpvasps

    Sequence, based on observed residues (ATOM records): (download) 
    >3iswB (B:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

  • Chain 'C':
    No sequence available.