PDB entry 3isq

View 3isq on RCSB PDB site
Description: Crystal structure of human 4-Hydroxyphenylpyruvate dioxygenase
Class: oxidoreductase
Keywords: HYDROXYPHENYLPYRUVATE, DIOXYGENASE, TYROSINE METABOLISM, Disease mutation, Iron, Mental retardation, Metal-binding, Oxidoreductase, Phenylalanine catabolism, Phosphoprotein, Tyrosine catabolism, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2009-08-27, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3isqa1, d3isqa2
  • Heterogens: CO, CL, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3isqA (A:)
    gakpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgki
    vfvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdk
    fgkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklpkcslemidhivgn
    qpdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpinepapgk
    kksqiqeyvdynggagvqhialktediitairhlrergleflsvpstyykqlreklktak
    ikvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrhnhqgfgagnfnsl
    fkafeeeqnlrgnltnmetngvvpgmaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isqA (A:)
    akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
    fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
    gkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklpkcslemidhivgnq
    pdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpinepapgkk
    ksqiqeyvdynggagvqhialktediitairhlrergleflsvpstyykqlreklktaki
    kvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrhnhqgfgagnfnslf
    kafeeeqnlrgnltnm