PDB entry 3is4

View 3is4 on RCSB PDB site
Description: Crystal structure of Leishmania mexicana pyruvate kinase (LmPYK)in complex with 1,3,6,8-pyrenetetrasulfonic acid
Class: transferase
Keywords: TRANSFERASE, Allosteric enzyme, ATP-binding, Glycolysis, Kinase, Magnesium, Metal-binding, Nucleotide-binding, Pyruvate
Deposited on 2009-08-25, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • see remark 999 (382)
      • see remark 999 (389)
      • see remark 999 (404-405)
    Domains in SCOPe 2.07: d3is4a1, d3is4a2, d3is4a3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • see remark 999 (382)
      • see remark 999 (389)
      • see remark 999 (404-405)
    Domains in SCOPe 2.07: d3is4b1, d3is4b2, d3is4b3
  • Heterogens: GOL, PTK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3is4A (A:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is4A (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    ayanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3is4B (B:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is4B (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    ayanqtrillve