PDB entry 3iru

View 3iru on RCSB PDB site
Description: Crystal structure of phoshonoacetaldehyde hydrolase like protein from Oleispira antarctica
Class: structural genomics, unknown function
Keywords: Oleispira antarctica, Phosphonoacetaldehyde hydrolase like protein, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2009-08-24, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phoshonoacetaldehyde hydrolase like protein
    Species: Oleispira antarctica [TaxId:188908]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IRU (Start-276)
    Domains in SCOPe 2.07: d3irua_
  • Chain 'B':
    Compound: phoshonoacetaldehyde hydrolase like protein
    Species: Oleispira antarctica [TaxId:188908]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IRU (Start-276)
    Domains in SCOPe 2.07: d3irub_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iruA (A:)
    ghmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgte
    ksehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevf
    dkliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvale
    levghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqh
    aeqrlfnagahyvidsvadletvitdvnrrlargekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iruA (A:)
    hmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgtek
    sehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfd
    kliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvalel
    evghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqha
    eqrlfnagahyvidsvadletvitdvnrrlargekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iruB (B:)
    ghmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgte
    ksehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevf
    dkliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvale
    levghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqh
    aeqrlfnagahyvidsvadletvitdvnrrlargekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iruB (B:)
    hmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgtek
    sehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfd
    kliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvalel
    evghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqha
    eqrlfnagahyvidsvadletvitdvnrrlargekp