PDB entry 3irr

View 3irr on RCSB PDB site
Description: Crystal Structure of a Z-Z junction (with HEPES intercalating)
Class: hydrolase/DNA
Keywords: Z-DNA, ADAR1, RNA EDITING, INNATE IMMUNITY, DNA JUNCTION, Z DOMAIN, INTERCALATION, Alternative promoter usage, Alternative splicing, Cytoplasm, Disease mutation, DNA-binding, Hydrolase, Isopeptide bond, Metal-binding, mRNA processing, Nucleus, Phosphoprotein, Polymorphism, RNA-binding, RNA-mediated gene silencing, Ubl conjugation, Zinc, HYDROLASE-DNA COMPLEX
Deposited on 2009-08-24, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, G1P1, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3irra1, d3irra2
  • Chain 'B':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, G1P1, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d3irrb1, d3irrb2
  • Chain 'C':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, G1P1, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d3irrc1, d3irrc2
  • Chain 'D':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, G1P1, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3irrd1, d3irrd2
  • Chain 'F':
    Compound: DNA (5'-d(*g*tp*cp*gp*cp*gp*cp*gp*tp*cp*gp*cp*gp*cp*g)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*a*cp*cp*gp*cp*gp*cp*gp*ap*cp*gp*cp*gp*cp*g)-3')
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3irrA (A:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kiavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irrA (A:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3irrB (B:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kiavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irrB (B:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    ia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3irrC (C:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kiavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irrC (C:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    ia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3irrD (D:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kiavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irrD (D:)
    gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
    kiav
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.