PDB entry 3irc

View 3irc on RCSB PDB site
Description: Crystal structure analysis of dengue-1 envelope protein domain III
Class: viral protein
Keywords: VIRUS, ENVELOPE, VIRAL PROTEIN, STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, ATP-binding, Envelope protein, Helicase, Hydrolase, Membrane, Nucleotide-binding, RNA replication, Transmembrane, Virion
Deposited on 2009-08-21, released 2009-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: envelope protein
  Species: Dengue virus 1 [TaxId:11053]
  Gene: ENVELOPE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9J7C6 (4-107)
  Domains in SCOPe 2.03: d3irca_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ircA (A:)
  mtlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrl
  itanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ircA (A:)
  gmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitan
  pivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig