PDB entry 3iqz

View 3iqz on RCSB PDB site
Description: Structure of F420 dependent methylene-tetrahydromethanopterin dehydrogenase in complex with methylene-tetrahydromethanopterin
Class: oxidoreductase
Keywords: binary complex of protein and substrate, OXIDOREDUCTASE, Methanogenesis, One-carbon metabolism
Deposited on 2009-08-21, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqza_
  • Chain 'B':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqzb_
  • Chain 'C':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqzc_
  • Chain 'D':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqzd_
  • Chain 'E':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqze_
  • Chain 'F':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqzf_
  • Heterogens: H4M, CA, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iqzA (A:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzA (A:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iqzB (B:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzB (B:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iqzC (C:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzC (C:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iqzD (D:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzD (D:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3iqzE (E:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzE (E:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3iqzF (F:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqzF (F:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe