PDB entry 3iqq

View 3iqq on RCSB PDB site
Description: X-ray structure of bovine TRTK12-Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2009-08-20, released 2010-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.223
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqqa_
  • Chain 'B':
    Compound: TRTK12 peptide, CapZ protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3IQQ
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3iqqA (A:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >3iqqA (A:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheff

  • Chain 'B':
    No sequence available.