PDB entry 3iqo

View 3iqo on RCSB PDB site
Description: 1.5 angstrom X-ray structure of bovine Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2009-08-20, released 2010-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.202
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqoa_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3iqob_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iqoA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqoA (A:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iqoB (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqoB (B:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheff