PDB entry 3iql

View 3iql on RCSB PDB site
Description: Crystal structure of the rat endophilin-A1 SH3 domain
Class: protein binding
Keywords: SH3, endophilin, Coiled coil, Cytoplasm, Endocytosis, Lipid-binding, Membrane, Phosphoprotein, SH3 domain, PROTEIN BINDING
Deposited on 2009-08-20, released 2009-11-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.128
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endophilin-A1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sh3d2a, Sh3gl2, Sh3p4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35179 (9-70)
      • expression tag (5-8)
    Domains in SCOPe 2.01: d3iqla_
  • Chain 'B':
    Compound: Endophilin-A1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sh3d2a, Sh3gl2, Sh3p4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35179 (9-70)
      • expression tag (4-8)
    Domains in SCOPe 2.01: d3iqlb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3iqlA (A:)
gsrrasvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpi
nyveilvalph

    Sequence, based on observed residues (ATOM records): (download) 
    >3iqlA (A:)
svgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyvei
lvalph

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3iqlB (B:)
gsrrasvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpi
nyveilvalph

    Sequence, based on observed residues (ATOM records): (download) 
    >3iqlB (B:)
asvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyve
ilvalph