PDB entry 3iqe

View 3iqe on RCSB PDB site
Description: Structure of F420 dependent methylene-tetrahydromethanopterin dehydrogenase in complex with methylene-tetrahydromethanopterin and coenzyme F420
Class: oxidoreductase
Keywords: ternary complex of protein, substrate and co-substrate, Methanogenesis, One-carbon metabolism, Oxidoreductase
Deposited on 2009-08-20, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqea_
  • Chain 'B':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqeb_
  • Chain 'C':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqec_
  • Chain 'D':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqed_
  • Chain 'E':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqee_
  • Chain 'F':
    Compound: F420-dependent methylenetetrahydromethanopterin dehydrogenase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: mtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqef_
  • Heterogens: H4M, F42, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iqeA (A:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeA (A:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iqeB (B:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeB (B:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iqeC (C:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeC (C:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iqeD (D:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeD (D:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3iqeE (E:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeE (E:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3iqeF (F:)
    mtvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldia
    edfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvk
    pdamlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpk
    lvidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahem
    mrkaaeladeareleksndavlrtphapdgkvlskrkfmedpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqeF (F:)
    tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
    dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
    damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
    vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
    rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe