PDB entry 3iqc

View 3iqc on RCSB PDB site
Description: Crystal structure of FliS from H. pylori
Class: chaperone
Keywords: flagella, chaperone, Flagellum
Deposited on 2009-08-20, released 2010-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_0753
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iqca_
  • Chain 'B':
    Compound: Flagellar protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_0753
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iqcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iqcA (A:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqcA (A:)
    yanayqayqhespakliemlyegilrfssqakrcienediekkiyyinrvtdiftellni
    ldyekggevavyltglythqikvltqanvendaskidlvlnvarglleawreihsdela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iqcB (B:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqcB (B:)
    pakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggevavy
    ltglythqikvltqanvendaskidlvlnvarglleawrei